| Edit |   |
| Antigenic Specificity | Growth Hormone 2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Growth Hormone 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Growth Hormone 2. This antibody reacts with human. The Growth Hormone 2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GH2(growth hormone 2) The peptide sequence was selected from the middle region of GH2. Peptide sequence LEEGIQTLIGWKMAAPGLGRSSISPTASLTQNRTTMTHCSRTTGCSTASG. |
| Other Names | GHL, GHVgrowth hormone variant, GH-VPlacenta-specific growth hormone, growth hormone 2hGH-V, placental-specific growth hormone |
| Gene, Accession # | GH2, Gene ID: 2689, Accession: O14644, SwissProt: O14644 |
| Catalog # | NBP1-59327 |
| Price | |
| Order / More Info | Growth Hormone 2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |