| Edit |   |
|---|
| Antigenic Specificity | Growth Hormone R |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Growth Hormone R Antibody from Novus Biologicals is a rabbit polyclonal antibody to Growth Hormone R. This antibody reacts with human. The Growth Hormone R Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GHR(growth hormone receptor) The peptide sequence was selected from the N terminal of Growth hormone receptor. Peptide sequence LQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLF. |
|---|
| Other Names | GH receptor, GHBP, growth hormone binding protein, growth hormone receptor, serum binding protein, Somatotropin receptor |
|---|
| Gene, Accession # | GHR, Gene ID: 2690, Accession: P10912, SwissProt: P10912 |
|---|
| Catalog # | NBP1-69449 |
|---|
| Price | |
|---|
| Order / More Info | Growth Hormone R Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|