| Edit |   |
|---|
| Antigenic Specificity | GRP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GRP Antibody from Novus Biologicals is a rabbit polyclonal antibody to GRP. This antibody reacts with mouse. The GRP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The specific Immunogen is proprietary information. Peptide sequence CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ. |
|---|
| Other Names | galectin-related protein, GRP, MGC33751, MGC71953 |
|---|
| Gene, Accession # | LGALSL, Gene ID: 29094, Accession: NP_776113 |
|---|
| Catalog # | NBP1-91457 |
|---|
| Price | |
|---|
| Order / More Info | GRP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|