| Edit |   |
| Antigenic Specificity | TMEM24 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TMEM24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM24. This antibody reacts with human. The TMEM24 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMEM24 The peptide sequence was selected from the C terminal of TMEM24. Peptide sequence AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL. |
| Other Names | C2 domain-containing protein 2-like, C2CD2-like, Transmembrane protein 24KIAA0285TMEM24 |
| Gene, Accession # | C2CD2L, Gene ID: 9854, Accession: O14523-2, SwissProt: O14523-2 |
| Catalog # | NBP1-62475 |
| Price | |
| Order / More Info | TMEM24 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |