| Edit |   |
|---|
| Antigenic Specificity | TMEM24 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM24 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM24. This antibody reacts with human. The TMEM24 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TMEM24 The peptide sequence was selected from the C terminal of TMEM24. Peptide sequence AGLSQSHDDLSNATATPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL. |
|---|
| Other Names | C2 domain-containing protein 2-like, C2CD2-like, Transmembrane protein 24KIAA0285TMEM24 |
|---|
| Gene, Accession # | C2CD2L, Gene ID: 9854, Accession: O14523-2, SwissProt: O14523-2 |
|---|
| Catalog # | NBP1-62475 |
|---|
| Price | |
|---|
| Order / More Info | TMEM24 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|