| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TMEM241 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM241 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM241. This antibody reacts with human. The TMEM241 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human TMEM241 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SRLAIPVFLTLHNVAEVIICGYQKCFQKEKTSPAKICSALLLLAAAGCLPFNDSQGLIKFYRSPRNPVH |
|---|
| Other Names | C18orf45, Chromosome 18 Open Reading Frame 45, hVVT, Putative Vertebrate Vrg4-Like Nucleotide-Sugar Transporter Truncated Variant2, Putative Vertebrate Vrg4-Like Nucleotide-Sugar Transporter Variant1, Transmembrane Protein 241, Transmembrane Protein C18orf45 |
|---|
| Gene, Accession # | TMEM241, Gene ID: 85019 |
|---|
| Catalog # | NBP2-56668 |
|---|
| Price | |
|---|
| Order / More Info | TMEM241 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|