| Edit |   |
|---|
| Antigenic Specificity | TMEM248 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMEM248 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMEM248. This antibody reacts with human. The TMEM248 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the N terminal of human C7orf42The immunogen for this antibody is C7ORF42. Peptide sequence FSINPLENLKVYISSRPPLVVFMISVSAMAIAFLTLGYFFKIKEIKSPEM. |
|---|
| Other Names | C7orf42, transmembrane protein 248 |
|---|
| Gene, Accession # | TMEM248, Gene ID: 55069, Accession: NP_060464, SwissProt: NP_060464 |
|---|
| Catalog # | NBP1-79208 |
|---|
| Price | |
|---|
| Order / More Info | TMEM248 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|