| 产品详情 |
| Edit |   |
| Antigenic Specificity | SF-1/NR5A1/Steroidogenic Factor 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SF-1/NR5A1/Steroidogenic Factor 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SF-1/NR5A1/Steroidogenic Factor 1. This antibody reacts with human. The SF-1/NR5A1/Steroidogenic Factor 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to SF1/Steroidogenic Factor 1 The peptide sequence was selected from the middle region of SF1/Steroidogenic Factor 1. Peptide sequence SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA. |
| Other Names | AD4BPSTF-1, Adrenal 4-binding protein, ELP, FTZ1adrenal 4 binding protein, FTZF1nuclear receptor AdBP4, Fushi tarazu factor homolog 1, Nuclear receptor subfamily 5 group A member 1, nuclear receptor subfamily 5, group A, member 1, SF-1POF7, SF1steroidogenic factor 1, Steroid hormone receptor Ad4BP, steroidogenic factor-1 |
| Gene, Accession # | NR5A1, Gene ID: 2516, Accession: Q13285, SwissProt: Q13285 |
| Catalog # | NBP1-52823-20ul |
| Price | |
| Order / More Info | SF-1/NR5A1/Steroidogenic Factor 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28592511, 30529237 |
| 产品资料 |
|
|