| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | P11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The P11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to P11. This antibody reacts with human. The P11 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human P11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KIESCASRCNEKFNRDAACQCDRRCLWHGNCCEDYEHLCTEDHKESEPLPQLEEETEEALASNLYSAPTSCQGRCYEAFDKHHQCHCNARCQ |
|---|
| Other Names | EC 3.1, endonuclease, polyU-specific, MGC133268, P11,26 serine protease, Placental protein 11, poly(U)-specific endoribonuclease, PP1122 serine protease, Protein endoU, PRSS26, Uridylate-specific endoribonuclease |
|---|
| Gene, Accession # | ENDOU, Gene ID: 8909 |
|---|
| Catalog # | NBP2-55877 |
|---|
| Price | |
|---|
| Order / More Info | P11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|