| 产品详情 |
| Edit |   |
| Antigenic Specificity | SIN3A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SIN3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to SIN3A. This antibody reacts with human. The SIN3A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SIN3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQSSGSHGPAIAAVHSSHHHPTAVQPHGGQVV |
| Other Names | DKFZp434K2235, FLJ90319, Histone deacetylase complex subunit Sin3a, KIAA0700, paired amphipathic helix protein Sin3a, SIN3 homolog A, transcription regulator (yeast), SIN3 homolog A, transcriptional regulator (yeast), transcriptional co-repressor Sin3A, Transcriptional corepressor Sin3a, transcriptional regulator, SIN3A |
| Gene, Accession # | SIN3A, Gene ID: 25942, Accession: Q96ST3, SwissProt: Q96ST3 |
| Catalog # | NBP2-38949 |
| Price | |
| Order / More Info | SIN3A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|