| 产品详情 |
| Edit |   |
| Antigenic Specificity | SIN3B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 28857552). |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SIN3B Antibody from Novus Biologicals is a rabbit polyclonal antibody to SIN3B. This antibody reacts with human. The SIN3B Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SIN3B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LISYYVKRQPAIQKEDQGTIHQLLHQFVPSLFFSQQLDLGASEESADEDR DSPQGQTTDPSERKKPAPGPHSSPPEEKGAFGDAPATEQPP |
| Other Names | Histone deacetylase complex subunit Sin3b, KIAA0700paired amphipathic helix protein Sin3b, SIN3 homolog B, transcription regulator (yeast), SIN3 homolog B, transcriptional regulator, SIN3 homolog B, transcriptional regulator (yeast), Transcriptional corepressor Sin3b |
| Gene, Accession # | SIN3B, Gene ID: 23309 |
| Catalog # | NBP2-13309 |
| Price | |
| Order / More Info | SIN3B Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 28857552 |
| 产品资料 |
|
|