| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Thioredoxin-like 5/TRP14/TXNDC17 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Thioredoxin-like 5/TRP14/TXNDC17 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Thioredoxin-like 5/TRP14/TXNDC17. This antibody reacts with human. The Thioredoxin-like 5/TRP14/TXNDC17 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Thioredoxin-like 5/TRP14/TXNDC17 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MARYEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISE |
|---|
| Other Names | MGC14353, Protein 42-9-9, thioredoxin (Trx)-related protein, 14 kDa, thioredoxin domain containing 17, thioredoxin domain-containing protein 17, thioredoxin-like 5, Thioredoxin-like protein 5, TRP1414 kDa thioredoxin-related protein, TXNL5 |
|---|
| Gene, Accession # | TXNDC17, Gene ID: 84817, Accession: Q9BRA2, Q9BRA2, Q9BRA2, Q9BRA2 |
|---|
| Catalog # | NBP1-81204 |
|---|
| Price | |
|---|
| Order / More Info | Thioredoxin-like 5/TRP14/TXNDC17 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|