| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GTF3C6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GTF3C6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GTF3C6. This antibody reacts with human. The GTF3C6 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GTF3C6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP |
|---|
| Other Names | bA397G5.3, C6orf51chromosome 6 open reading frame 51, general transcription factor 3C polypeptide 6, general transcription factor IIIC, polypeptide 6, alpha 35kDa, TFIIIC35TFIIIC 35 kDa subunit, Transcription factor IIIC 35 kDa subunit, transcription factor IIIC 35kDa, Transcription factor IIIC subunit 6 |
|---|
| Gene, Accession # | GTF3C6, Gene ID: 112495, Accession: Q969F1, SwissProt: Q969F1 |
|---|
| Catalog # | NBP2-31851 |
|---|
| Price | |
|---|
| Order / More Info | GTF3C6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|