| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Thioredoxin Reductase 1/TRXR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Thioredoxin Reductase 1/TRXR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Thioredoxin Reductase 1/TRXR1. This antibody reacts with human. The Thioredoxin Reductase 1/TRXR1 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human Thioredoxin Reductase 1/TRXR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVML |
|---|
| Other Names | EC 1.8.1, EC 1.8.1.9, Gene associated with retinoic and IFN-induced mortality 12 protein, Gene associated with retinoic and interferon-induced mortality 12 protein, GRIM12, GRIM-12TR1, KDRF, KM-102-derived reductase-like factor, MGC9145, oxidoreductase, thioredoxin reductase 1, thioredoxin reductase 1, cytoplasmic, thioredoxin reductase GRIM-12, Thioredoxin reductase TR1, TR, Trxr1, TXNRTRXR1 |
|---|
| Gene, Accession # | TXNRD1, Gene ID: 7296 |
|---|
| Catalog # | NBP2-55363 |
|---|
| Price | |
|---|
| Order / More Info | Thioredoxin Reductase 1/TRXR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|