| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GTF2H2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GTF2H2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GTF2H2. This antibody reacts with human. The GTF2H2 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human GTF2H2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG |
|---|
| Other Names | Basic transcription factor 2 44 kDa subunit, BTF2, BTF2 p44, BTF2P44TFIIH basal transcription factor complex p44 subunit, General transcription factor IIH polypeptide 2, general transcription factor IIH subunit 2, general transcription factor IIH, polypeptide 2 (44kD subunit), general transcription factor IIH, polypeptide 2, 44kD subunit, general transcription factor IIH, polypeptide 2, 44kDa, MGC102806, T-BTF2P44, TFIIH |
|---|
| Gene, Accession # | GTF2H2, Gene ID: 2966 |
|---|
| Catalog # | NBP2-56841 |
|---|
| Price | |
|---|
| Order / More Info | GTF2H2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|