| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GTF2H4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GTF2H4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GTF2H4. This antibody reacts with human. The GTF2H4 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human GTF2H4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDKYAEERWEVVL |
|---|
| Other Names | Basic transcription factor 2 52 kDa subunit, BTF2 p52, General transcription factor IIH polypeptide 4, general transcription factor IIH subunit 4, general transcription factor IIH, polypeptide 4 (52kD subunit), general transcription factor IIH, polypeptide 4, 52kDa, TFB2, TFIIH, TFIIH basal transcription factor complex p52 subunit |
|---|
| Gene, Accession # | GTF2H4, Gene ID: 2968 |
|---|
| Catalog # | NBP2-57537 |
|---|
| Price | |
|---|
| Order / More Info | GTF2H4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|