| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TH1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TH1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to TH1L. This antibody reacts with human. The TH1L Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human TH1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ETVENHLKSLLIKHFDPRKADSIFTEEGETPAWLEQMIAHTTWRDLFYKLAEAHPDCLMLNFTVKLISDAGYQGEITSVS |
|---|
| Other Names | HSPC130, negative elongation factor proteins C and D, NELF-C, NELF-C/D, NELFD, NELF-D, TH1 drosophila homolog, TH1-like (Drosophila homolog), TH1-like (Drosophila), TH1-like protein, TH1negative elongation factor C/D, trihydrophobin 1 |
|---|
| Gene, Accession # | TH1L, Gene ID: 51497 |
|---|
| Catalog # | NBP2-55400 |
|---|
| Price | |
|---|
| Order / More Info | TH1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|