| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATP5F1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATP5F1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP5F1. This antibody reacts with human. The ATP5F1 Antibody has been validated for the following applications: Western Blot. This product is specific to Subunit or Isoform: b, mitochondrial |
|---|
| Immunogen | Synthetic peptides corresponding to ATP5F1(ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1) The peptide sequence was selected from the middle region of ATP5F1. Peptide sequence VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEK |
|---|
| Other Names | ATP synthase B chain, mitochondrial, ATP synthase subunit b, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1, ATPase subunit b, cell proliferation-inducing protein 47, H+-ATP synthase subunit b, MGC24431, PIG47 |
|---|
| Gene, Accession # | ATP5F1, Gene ID: 515, Accession: P24539, SwissProt: P24539 |
|---|
| Catalog # | NBP1-54702 |
|---|
| Price | |
|---|
| Order / More Info | ATP5F1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|