| Edit |   |
|---|
| Antigenic Specificity | MLC1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MLC1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MLC1. This antibody reacts with human. The MLC1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MLC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: NVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQI |
|---|
| Other Names | LVM, megalencephalic leukoencephalopathy with subcortical cysts 1, WKL1 |
|---|
| Gene, Accession # | MLC1, Gene ID: 23209, Accession: Q15049, SwissProt: Q15049 |
|---|
| Catalog # | NBP2-39086 |
|---|
| Price | |
|---|
| Order / More Info | MLC1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|