| 产品详情 |
| Edit |   |
| Antigenic Specificity | ATP5F1 |
| Clone | polyclonal |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified, no preservative |
| Size | 0.05 mg |
| Concentration | n/a |
| Applications | Western Blot. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATP5F1 Antibody from Novus Biologicals is a mouse polyclonal antibody to ATP5F1. This antibody reacts with human. The ATP5F1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | ATP5F1 (NP_001679.2, 1 a.a. - 256 a.a.) full-length human protein. MLSRVVLSAAATAAPSLKNAAFLGPGVLQATRTFHTGQPHLVPVPPLPEYGGKVRYGLIPEEFFQFLYPKTGVTGPYVLGTGLILYALSKEIYVISAETFTALSVLGVMVYGIKKYGPFVADFADKLNEQKLAQLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISTQQEKETIAKCIADLKLLAKKAQAQPVM |
| Other Names | ATP synthase B chain, mitochondrial, ATP synthase subunit b, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit b, isoform 1, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1, ATPase subunit b, cell proliferation-inducing protein 47, H+-ATP synthase subunit b, MGC24431, PIG47 |
| Gene, Accession # | ATP5F1, Gene ID: 515, Accession: NP_001679.2, SwissProt: NP_001679.2 |
| Catalog # | H00000515-B02P |
| Price | |
| Order / More Info | ATP5F1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|