| 产品详情 |
| Edit |   |
| Antigenic Specificity | MLC1SA |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MLC1SA Antibody from Novus Biologicals is a rabbit polyclonal antibody to MLC1SA. This antibody reacts with human. The MLC1SA Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MLC1SA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: APPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFKE |
| Other Names | MLC1sa, MLC1SAmyosin light chain 1, slow-twitch muscle A isoform, myosin alkali light chain 1 slow a, myosin light chain 1 slow a, Myosin light chain 1 slow-twitch muscle A isoform, myosin light chain 6B, myosin, light chain 6B, alkali, smooth muscle and non-muscle, myosin, light polypeptide 6B, alkali, smooth muscle and non-muscle, smooth muscle and non-muscle myosin alkali light chain 6B, Smooth muscle and nonmuscle myosin light chain alkali 6B |
| Gene, Accession # | MYL6B, Gene ID: 140465 |
| Catalog # | NBP1-92124 |
| Price | |
| Order / More Info | MLC1SA Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|