| 产品详情 |
| Edit |   |
| Antigenic Specificity | ATP5G2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The ATP5G2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATP5G2. This antibody reacts with human. The ATP5G2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ATP5G2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLK RPEILTDESLSSLAVSCPLTSLVSSRSFQ |
| Other Names | ATP synthase lipid-binding protein, mitochondrial, ATP synthase proteolipid P2, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit c (subunit 9), ATP synthase, H+ transporting, mitochondrial F0 complex, subunit C2 (subunit 9), ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9), ATPase protein 9, ATPase subunit c, isoform 2, mitochondrial ATP synthase, subunit C (subunit 9) |
| Gene, Accession # | ATP5G2, Gene ID: 517 |
| Catalog # | NBP2-14331 |
| Price | |
| Order / More Info | ATP5G2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|