| Edit |   |
| Antigenic Specificity | MLEC |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MLEC Antibody from Novus Biologicals is a rabbit polyclonal antibody to MLEC. This antibody reacts with human. The MLEC Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human KIAA0152. Peptide sequence TVDDVPKLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRVQSGPRTPNP. |
| Other Names | malectin |
| Gene, Accession # | MLEC, Gene ID: 9761, Accession: NP_055545, SwissProt: NP_055545 |
| Catalog # | NBP1-91602 |
| Price | |
| Order / More Info | MLEC Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |