| Edit |   |
| Antigenic Specificity | KIAA1704 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KIAA1704 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIAA1704. This antibody reacts with human. The KIAA1704 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human KIAA1704The immunogen for this antibody is KIAA1704. Peptide sequence KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG. |
| Other Names | AD029, hypothetical protein LOC55425, KIAA1704, lipopolysaccharide-specific response protein 7, LSR7 |
| Gene, Accession # | KIAA1704, Gene ID: 55425, Accession: NP_061029, SwissProt: NP_061029 |
| Catalog # | NBP1-79666-20ul |
| Price | |
| Order / More Info | KIAA1704 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |