| Edit |   |
| Antigenic Specificity | KIAA1958 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KIAA1958 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIAA1958. This antibody reacts with human. The KIAA1958 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to KIAA1958(KIAA1958) The peptide sequence was selected from the C terminal of KIAA1958. Peptide sequence SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDS. |
| Other Names | FLJ39294, hypothetical protein LOC158405, KIAA1958, MGC142075 |
| Gene, Accession # | KIAA1958, Gene ID: 158405 |
| Catalog # | NBP1-56708-20ul |
| Price | |
| Order / More Info | KIAA1958 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |