| 产品详情 |
| Edit |   |
| Antigenic Specificity | FE65 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The FE65 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FE65. This antibody reacts with human. The FE65 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FE65 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QEESQLTWTGFAHGEGFEDGEFWKDEPSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPPRNTNPGI |
| Other Names | adaptor protein FE65a2, amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65), amyloid beta A4 precursor protein-binding, family B, member 1, Fe65, FE65amyloid beta A4 precursor protein-binding family B member 1, MGC:9072, Protein Fe65, RIR, stat-like protein |
| Gene, Accession # | APBB1, Gene ID: 322 |
| Catalog # | NBP2-48682 |
| Price | |
| Order / More Info | FE65 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|