| Edit |   |
| Antigenic Specificity | KIAA1324L |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KIAA1324L Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIAA1324L. This antibody reacts with human. The KIAA1324L Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human KIAA1324L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ('YFHFFNISLCGHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADTFIGVTVETT',) |
| Other Names | estrogen-induced gene 121-like protein, FLJ31340, KIAA1324-like |
| Gene, Accession # | KIAA1324L, Gene ID: 222223 |
| Catalog # | NBP2-55924 |
| Price | |
| Order / More Info | KIAA1324L Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |