| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | KIBRA |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The KIBRA Antibody from Novus Biologicals is a rabbit polyclonal antibody to KIBRA. This antibody reacts with human. The KIBRA Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human KIBRA antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PPCSPLMADPLLAGDAFLNSLEFEDPELSATLCELSLGNSAQERYRLEEPGTEGKQLGQAVNTAQGC |
|---|
| Other Names | FLJ10865, FLJ23369, HBeAg-binding protein 3, KIAA0869HBEBP3, KIBRAHBEBP36, Kidney and brain protein, protein KIBRA, protein WWC1, WW and C2 domain containing 1, WW domain-containing protein 1, WW, C2 and coiled-coil domain containing 1 |
|---|
| Gene, Accession # | WWC1, Gene ID: 23286 |
|---|
| Catalog # | NBP1-92053 |
|---|
| Price | |
|---|
| Order / More Info | KIBRA Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|