| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | A20/TNFAIP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The A20/TNFAIP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to A20/TNFAIP3. This antibody reacts with human. The A20/TNFAIP3 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AEQVLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKTMHRYTLEMFRTCQFCPQFREIIHKALIDRNIQATLESQKKLNWCREV |
|---|
| Other Names | A20TNFA1P2, EC 3.4.19.12, EC 6.3.2.-, MGC104522, MGC138687, OTU domain-containing protein 7C, OTUD7CMGC138688, Putative DNA-binding protein A20, TNF alpha-induced protein 3, tumor necrosis factor alpha-induced protein 3, tumor necrosis factor inducible protein A20, tumor necrosis factor, alpha-induced protein 3, Zinc finger protein A20 |
|---|
| Gene, Accession # | TNFAIP3, Gene ID: 7128 |
|---|
| Catalog # | NBP2-68857 |
|---|
| Price | |
|---|
| Order / More Info | A20/TNFAIP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|