| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SNAPC3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SNAPC3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SNAPC3. This antibody reacts with human. The SNAPC3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human SNAPC3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPELNTRAFHVGAFGELWRGRLRGAGDLSLREPPASALPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEVIPENTDLVT |
|---|
| Other Names | MGC132011, MGC33124, Proximal sequence element-binding transcription factor subunit beta, PSE-binding factor subunit beta, PTF subunit beta, PTFbeta, small nuclear RNA activating complex, polypeptide 3, 50kD, small nuclear RNA activating complex, polypeptide 3, 50kDa, Small nuclear RNA-activating complex polypeptide 3, SNAP50SNAPc 50 kDa subunit, SNAPc subunit 3, snRNA-activating protein complex 50 kDa subunit, snRNA-activating protein complex subunit 3 |
|---|
| Gene, Accession # | SNAPC3, Gene ID: 6619 |
|---|
| Catalog # | NBP2-57713 |
|---|
| Price | |
|---|
| Order / More Info | SNAPC3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|