| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ATOH7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Western Blot reported in scientific literature (PMID: 29225067). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ATOH7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ATOH7. This antibody reacts with human, mouse. The ATOH7 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse ATOH7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT |
|---|
| Other Names | ATH5, atonal homolog 7 (Drosophila), BHLHA13, bHLHa13protein atonal homolog 7, Class A basic helix-loop-helix protein 13, hATH5, Helix-loop-helix protein hATH-5, Math5 |
|---|
| Gene, Accession # | ATOH7, Gene ID: 220202 |
|---|
| Catalog # | NBP1-88639 |
|---|
| Price | |
|---|
| Order / More Info | ATOH7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29225067, 29977079 |
|---|
| 产品资料 |
|
|