| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HR6B/UBE2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HR6B/UBE2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to HR6B/UBE2B. This antibody reacts with human. The HR6B/UBE2B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human HR6B/UBE2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQ |
|---|
| Other Names | E2 protein, E2-17kDa, HHR6B, HR6B, RAD6 homolog B, RAD6BEC 6.3.2.19, UBC2, Ubiquitin carrier protein B, ubiquitin-conjugating enzyme E2 B, Ubiquitin-conjugating enzyme E2-17 kDa, ubiquitin-conjugating enzyme E2B (RAD6 homolog), Ubiquitin-protein ligase B |
|---|
| Gene, Accession # | UBE2B, Gene ID: 7320 |
|---|
| Catalog # | NBP2-58772 |
|---|
| Price | |
|---|
| Order / More Info | HR6B/UBE2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|