| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | HR6B/UBE2B |
|---|
| Clone | 4C3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The HR6B/UBE2B Antibody (4C3) from Novus Biologicals is a mouse monoclonal antibody to HR6B/UBE2B. This antibody reacts with human. The HR6B/UBE2B Antibody (4C3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | UBE2B (NP_003328.1 63 a.a. - 152 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWNDS |
|---|
| Other Names | E2 protein, E2-17kDa, HHR6B, HR6B, RAD6 homolog B, RAD6BEC 6.3.2.19, UBC2, Ubiquitin carrier protein B, ubiquitin-conjugating enzyme E2 B, Ubiquitin-conjugating enzyme E2-17 kDa, ubiquitin-conjugating enzyme E2B (RAD6 homolog), Ubiquitin-protein ligase B |
|---|
| Gene, Accession # | UBE2B, Gene ID: 7320, Accession: NP_003328, SwissProt: NP_003328 |
|---|
| Catalog # | H00007320-M06 |
|---|
| Price | |
|---|
| Order / More Info | HR6B/UBE2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|