| Edit |   |
|---|
| Antigenic Specificity | 4930567H17Rik |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The 4930567H17Rik Antibody from Novus Biologicals is a rabbit polyclonal antibody to 4930567H17Rik. This antibody reacts with mouse. The 4930567H17Rik Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is 4930567H17Rik. Peptide sequence TLSSYDPCRYILKAALSVITAWENTLEEEEEDEEEDEEEEEMEEEDEGEE. |
|---|
| Other Names | 4930567H17Rik RIKEN cDNA 4930567H17 gene |
|---|
| Gene, Accession # | 4930567H17RIK, Gene ID: 619303, Accession: NP_001028979 |
|---|
| Catalog # | NBP1-98255-20ul |
|---|
| Price | |
|---|
| Order / More Info | 4930567H17Rik Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|