| 产品详情 |
| Edit |   |
| Antigenic Specificity | Cortactin |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cortactin Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cortactin. This antibody reacts with human. The Cortactin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cortactin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF |
| Other Names | 1110020L01Rik, Amplaxin, cortactin, ems1 sequence (mammary tumor and squamous cell carcinoma-associated (p80/85 srcsubstrate), EMS1amplaxin, FLJ34459, Oncogene EMS1, src substrate cortactin |
| Gene, Accession # | CTTN, Gene ID: 2017, Accession: Q14247, SwissProt: Q14247 |
| Catalog # | NBP2-38826 |
| Price | |
| Order / More Info | Cortactin Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|