| Edit |   |
|---|
| Antigenic Specificity | Corticotropin Releasing Factor |
|---|
| Clone | 2B11 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Corticotropin Releasing Factor Antibody (2B11) from Novus Biologicals is a mouse monoclonal antibody to Corticotropin Releasing Factor. This antibody reacts with human. The Corticotropin Releasing Factor Antibody (2B11) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CRH (AAH11031 154 a.a. - 196 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK |
|---|
| Other Names | corticoliberin, corticotropin releasing hormone, Corticotropin-releasing hormone, CRFCorticotropin-releasing factor |
|---|
| Gene, Accession # | CRH, Gene ID: 1392, Accession: AAH11031, SwissProt: AAH11031 |
|---|
| Catalog # | H00001392-M02 |
|---|
| Price | |
|---|
| Order / More Info | Corticotropin Releasing Factor Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 22734038, 23239753, 24276461 |
|---|