| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | COUP-TF II/NR2F2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. ICC/IF Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COUP-TF II/NR2F2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COUP-TF II/NR2F2. This antibody reacts with human. The COUP-TF II/NR2F2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAA |
|---|
| Other Names | Apolipoprotein A-I regulatory protein 1, ARP-1, ARP1ADP-ribosylation factor related protein 1, chicken ovalbumin upstream promoter transcription factor 2, COUP transcription factor 2, COUP transcription factor II, COUP-TF II, COUP-TF2, COUPTFB, COUPTFII, COUP-TFII, MGC117452, Nuclear receptor subfamily 2 group F member 2, nuclear receptor subfamily 2, group F, member 2, SVP40, TFCOUP2apolipoprotein AI regulatory protein 1 |
|---|
| Gene, Accession # | NR2F2, Gene ID: 7026 |
|---|
| Catalog # | NBP2-68746 |
|---|
| Price | |
|---|
| Order / More Info | COUP-TF II/NR2F2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|