| 产品详情 |
| Edit |   |
| Antigenic Specificity | COUP-TF II/NR2F2 |
| Clone | polyclonal |
| Host Species | Mouse |
| Reactive Species | human |
| Isotype | n/a |
| Format | Protein A purified, no preservative |
| Size | 0.05 mg |
| Concentration | n/a |
| Applications | Western Blot. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The COUP-TF II/NR2F2 Antibody from Novus Biologicals is a mouse polyclonal antibody to COUP-TF II/NR2F2. This antibody reacts with human. The COUP-TF II/NR2F2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | NR2F2 (NP_066285.1, 1 a.a. - 414 a.a.) full-length human protein. MAMVVSTWRDPQDEVPGSQGSQASQAPPVPGPPPGAPHTPQTPGQGGPASTPAQTAAGGQGGPGGPGSDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVALLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMAIQ |
| Other Names | Apolipoprotein A-I regulatory protein 1, ARP-1, ARP1ADP-ribosylation factor related protein 1, chicken ovalbumin upstream promoter transcription factor 2, COUP transcription factor 2, COUP transcription factor II, COUP-TF II, COUP-TF2, COUPTFB, COUPTFII, COUP-TFII, MGC117452, Nuclear receptor subfamily 2 group F member 2, nuclear receptor subfamily 2, group F, member 2, SVP40, TFCOUP2apolipoprotein AI regulatory protein 1 |
| Gene, Accession # | NR2F2, Gene ID: 7026, Accession: NP_066285.1, SwissProt: NP_066285.1 |
| Catalog # | H00007026-B01P |
| Price | |
| Order / More Info | COUP-TF II/NR2F2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|