| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | COUP-TF II/NR2F2 |
|---|
| Clone | 3B5 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA. It has been used for ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COUP-TF II/NR2F2 Antibody (3B5) from Novus Biologicals is a mouse monoclonal antibody to COUP-TF II/NR2F2. This antibody reacts with human. The COUP-TF II/NR2F2 Antibody (3B5) has been validated for the following applications: ELISA. |
|---|
| Immunogen | NR2F2 (NP_066285 153 a.a. - 240 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITD |
|---|
| Other Names | Apolipoprotein A-I regulatory protein 1, ARP-1, ARP1ADP-ribosylation factor related protein 1, chicken ovalbumin upstream promoter transcription factor 2, COUP transcription factor 2, COUP transcription factor II, COUP-TF II, COUP-TF2, COUPTFB, COUPTFII, COUP-TFII, MGC117452, Nuclear receptor subfamily 2 group F member 2, nuclear receptor subfamily 2, group F, member 2, SVP40, TFCOUP2apolipoprotein AI regulatory protein 1 |
|---|
| Gene, Accession # | NR2F2, Gene ID: 7026, Accession: NP_066285, SwissProt: NP_066285 |
|---|
| Catalog # | H00007026-M10 |
|---|
| Price | |
|---|
| Order / More Info | COUP-TF II/NR2F2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|