| Edit |   |
| Antigenic Specificity | PTDSS1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PTDSS1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTDSS1. This antibody reacts with human. The PTDSS1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to PTDSS1(phosphatidylserine synthase 1) The peptide sequence was selected from the N terminal of PTDSS1. Peptide sequence MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI. |
| Other Names | KIAA0024Serine-exchange enzyme I, phosphatidylserine synthase 1, PSS1EC 2.7.8.-, PSSAPSS-1, PtdSer synthase 1 |
| Gene, Accession # | PTDSS1, Gene ID: 9791, Accession: P48651, SwissProt: P48651 |
| Catalog # | NBP1-59966-20ul |
| Price | |
| Order / More Info | PTDSS1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |