| Edit |   |
| Antigenic Specificity | PTDSS2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PTDSS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PTDSS2. This antibody reacts with human. The PTDSS2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the middle region of human PTDSS2. Peptide sequence QAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGSVLALTWTVWR. |
| Other Names | phosphatidylserine synthase 2, serine-exchange enzyme II |
| Gene, Accession # | PTDSS2, Gene ID: 81490, Accession: NP_110410, SwissProt: NP_110410 |
| Catalog # | NBP1-91352-20ul |
| Price | |
| Order / More Info | PTDSS2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |