| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | USP9x |
|---|
| Clone | 1C4 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA. Use in Immunohistochemistry-paraffin reported in scientific literature (PMID: 20023629). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The USP9x Antibody (1C4) from Novus Biologicals is a mouse monoclonal antibody to USP9x. This antibody reacts with human. The USP9x Antibody (1C4) has been validated for the following applications: Western Blot, ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | USP9X (NP_068706, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQLEDEEPAFPHTDLAKLDDMINRPRWVVPVLP |
|---|
| Other Names | Deubiquitinating enzyme FAF-X, DFFRXubiquitin specific protease 9, X-linked (fat facets-like, Drosophila), Drosophila fat facets related, X-linked, EC 3.1.2.15, EC 3.4.19.12, FAF, FAM, Fat facets in mammals, fat facets protein related, X-linked, Fat facets protein-related, X-linked, hFAM, probable ubiquitin carboxyl-terminal hydrolase FAF-X, ubiquitin specific peptidase 9, X-linked, ubiquitin specific peptidase 9, X-linked (fat facets-like, Drosophila), ubiquitin thioesterase FAF-X, Ubiquitin thiolesterase FAF-X, ubiquitin-specific processing protease FAF-X, Ubiquitin-specific protease 9, X chromosome, Ubiquitin-specific-processing protease FAF-X, USP9, X chromosome (fat facets-like Drosophila) |
|---|
| Gene, Accession # | USP9X, Gene ID: 8239 |
|---|
| Catalog # | H00008239-M01 |
|---|
| Price | |
|---|
| Order / More Info | USP9x Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20023629, 20799354, 22525702, 23097624, 24769731, 26598551, 26775694 |
|---|
| 产品资料 |
|
|