| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | USP9Y |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The USP9Y Antibody from Novus Biologicals is a rabbit polyclonal antibody to USP9Y. This antibody reacts with human. The USP9Y Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide directed towards the C terminal of human USP9YThe immunogen for this antibody is USP9Y. Peptide sequence PHSPASQYQQNNHVHGQPYTGPAAHHLNNPQKTGQRTQENYEGNEEVSSP. |
|---|
| Other Names | Deubiquitinating enzyme FAF-Y, DFFRYFLJ33043, EC 3.1.2.15, EC 3.4.19.12, Fat facets protein-related, Y-linked, probable ubiquitin carboxyl-terminal hydrolase FAF-Y, ubiquitin specific peptidase 9, Y-linked, ubiquitin specific peptidase 9, Y-linked (fat facets-like, Drosophila), ubiquitin thioesterase FAF-Y, Ubiquitin thiolesterase FAF-Y, ubiquitin-specific processing protease FAF-Y, Ubiquitin-specific protease 9, Y chromosome, Ubiquitin-specific-processing protease FAF-Y |
|---|
| Gene, Accession # | USP9Y, Gene ID: 8287, Accession: NP_004645, SwissProt: NP_004645 |
|---|
| Catalog # | NBP1-79749 |
|---|
| Price | |
|---|
| Order / More Info | USP9Y Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|