| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | USP9Y |
|---|
| Clone | 2D3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The USP9Y Antibody (2D3) from Novus Biologicals is a mouse monoclonal antibody to USP9Y. This antibody reacts with human. The USP9Y Antibody (2D3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | USP9Y (NP_004645 3 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AITHGSPVGGNDSQGQVLDGQSQHLFQQNQTSSPDSSNENSVATPPPEEQGQGDAPPQHEDEEPAFPHTELANLDDMINRPRWVVPVL |
|---|
| Other Names | Deubiquitinating enzyme FAF-Y, DFFRYFLJ33043, EC 3.1.2.15, EC 3.4.19.12, Fat facets protein-related, Y-linked, probable ubiquitin carboxyl-terminal hydrolase FAF-Y, ubiquitin specific peptidase 9, Y-linked, ubiquitin specific peptidase 9, Y-linked (fat facets-like, Drosophila), ubiquitin thioesterase FAF-Y, Ubiquitin thiolesterase FAF-Y, ubiquitin-specific processing protease FAF-Y, Ubiquitin-specific protease 9, Y chromosome, Ubiquitin-specific-processing protease FAF-Y |
|---|
| Gene, Accession # | USP9Y, Gene ID: 8287, Accession: NP_004645, SwissProt: NP_004645 |
|---|
| Catalog # | H00008287-M05 |
|---|
| Price | |
|---|
| Order / More Info | USP9Y Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|