| Edit |   |
|---|
| Antigenic Specificity | UTP15 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UTP15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UTP15. This antibody reacts with mouse. The UTP15 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Utp15 - middle region. Peptide sequence DETIVVGMTNGILSVKHRKSEAKKTSLPRRRRPAYRTFIKGKNYLKQRDD. |
|---|
| Other Names | U3 small nucleolar ribonucleoprotein, homolog (yeast), U3 small nucleolar RNA-associated protein 15 homolog, UTP15, U3 small nucleolar ribonucleoprotein, homolog (S. cerevisiae) |
|---|
| Gene, Accession # | UTP15, Gene ID: 84135, Accession: NP_849249 |
|---|
| Catalog # | NBP1-98382 |
|---|
| Price | |
|---|
| Order / More Info | UTP15 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|