| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UTP20 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UTP20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UTP20. This antibody reacts with human. The UTP20 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human UTP20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FETLSDFESGLKYITDVVKLNAFDQRHLDDINFDVRFETFQTITSYIKEMQIVDVNYLIPVMHNCFYNLELGDMSLSDNASMC |
|---|
| Other Names | Down-regulated in metastasis protein, DRIMdown regulated in metastasis, NNP73, Novel nucleolar protein 73, Protein Key-1A6, small subunit processome component 20 homolog, UTP20, small subunit (SSU) processome component, homolog (yeast) |
|---|
| Gene, Accession # | UTP20, Gene ID: 27340 |
|---|
| Catalog # | NBP2-58128 |
|---|
| Price | |
|---|
| Order / More Info | UTP20 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|