| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UTP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UTP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UTP3. This antibody reacts with human. The UTP3 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human UTP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LNYCSNISFYLILKARRVPAHGHPVIERLVTYRNLINKLSVVDQKLSSEIRHLLTLKDDAVKKELIPKAKSTKPK |
|---|
| Other Names | Charged amino acid-rich leucine zipper 1, CRL1charged amino acid rich leucine zipper 1 homolog, CRLZ1UTP3 homolog, disrupter of silencing 10, Disrupter of silencing SAS10, FLJ23256, SAS10DKFZp761F222, something about silencing protein 10, UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) |
|---|
| Gene, Accession # | UTP3, Gene ID: 57050 |
|---|
| Catalog # | NBP2-58960 |
|---|
| Price | |
|---|
| Order / More Info | UTP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|