| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UTP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UTP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UTP3. This antibody reacts with human. The UTP3 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UTP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LQEDDFGVAWVEAFAKPVPQVDEAETRVVKDLAKVSVKEKLKMLRKESPELLELIEDLKVKLTEVKDELEPLLELVEQGIIPPGKGSQ |
|---|
| Other Names | Charged amino acid-rich leucine zipper 1, CRL1charged amino acid rich leucine zipper 1 homolog, CRLZ1UTP3 homolog, disrupter of silencing 10, Disrupter of silencing SAS10, FLJ23256, SAS10DKFZp761F222, something about silencing protein 10, UTP3, small subunit (SSU) processome component, homolog (S. cerevisiae) |
|---|
| Gene, Accession # | UTP3, Gene ID: 57050 |
|---|
| Catalog # | NBP1-85449 |
|---|
| Price | |
|---|
| Order / More Info | UTP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261 |
|---|
| 产品资料 |
|
|