| Edit |   |
| Antigenic Specificity | GDAP2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The GDAP2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GDAP2. This antibody reacts with human. The GDAP2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to GDAP2(ganglioside induced differentiation associated protein 2) The peptide sequence was selected from the N terminal of GDAP2. Peptide sequence SSLYSCYRNVLQLAKEQSMSSVGFCVINSAKRGYPLEDATHIALRTVRRF. |
| Other Names | dJ776P7.1, FLJ20142, ganglioside induced differentiation associated protein 2, ganglioside-induced differentiation-associated protein 2 |
| Gene, Accession # | GDAP2, Gene ID: 54834, Accession: Q9NXN4, SwissProt: Q9NXN4 |
| Catalog # | NBP1-56959-20ul |
| Price | |
| Order / More Info | GDAP2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |