| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GDC |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GDC Antibody from Novus Biologicals is a rabbit polyclonal antibody to GDC. This antibody reacts with human. The GDC Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human GDC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLY |
|---|
| Other Names | D10S105EGDC, GDASolute carrier family 25 member 16, Graves disease autoantigen, graves disease carrier protein, HGT.1, hML7, member 16, MGC39851, Mitochondrial solute carrier protein homolog, ML7, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen) |
|---|
| Gene, Accession # | SLC25A16, Gene ID: 8034 |
|---|
| Catalog # | NBP2-55076 |
|---|
| Price | |
|---|
| Order / More Info | GDC Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|