| Edit |   |
|---|
| Antigenic Specificity | IFI44 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IFI44 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFI44. This antibody reacts with human. The IFI44 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to IFI44(interferon-induced protein 44) The peptide sequence was selected from the middle region of IFI44. Peptide sequence LIEIERCEPVRSKLEEVQRKLGFALSDISVVSNYSSEWELDPVKDVLILS. |
|---|
| Other Names | interferon-induced protein 44, interferon-induced, hepatitis C-associated microtubular aggregate protein(44kD), MTAP44p44Microtubule-associated protein 44, P44 |
|---|
| Gene, Accession # | IFI44, Gene ID: 10561, Accession: Q8TCB0, SwissProt: Q8TCB0 |
|---|
| Catalog # | NBP1-55380 |
|---|
| Price | |
|---|
| Order / More Info | IFI44 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|